PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G161000.1
Common NamePHAVU_001G161000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 293aa    MW: 33186.7 Da    PI: 4.9897
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G161000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.3e-161461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT+eEd++l+ +++ +G  +W++ ++  g+ R++k+c++rw +yl
  Phvul.001G161000.1 14 RGPWTQEEDQILITYINTYGHANWRSLPKLAGLLRCGKSCRLRWINYL 61
                        89******************************99************97 PP

2Myb_DNA-binding49.87.8e-1667112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T eE++ ++ ++++lG++ W++Ia++++ gRt++++k+ w+++l
  Phvul.001G161000.1  67 RGNFTREEEDAIITLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                         89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.231961IPR017930Myb domain
SuperFamilySSF466896.53E-3010108IPR009057Homeodomain-like
SMARTSM007179.0E-141363IPR001005SANT/Myb domain
PfamPF002494.0E-151461IPR001005SANT/Myb domain
CDDcd001671.22E-101661No hitNo description
PROSITE profilePS5129425.30362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2665116IPR009057Homeodomain-like
SMARTSM007171.1E-1466114IPR001005SANT/Myb domain
PfamPF002491.0E-1467112IPR001005SANT/Myb domain
CDDcd001671.31E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTQE EDQILITYIN TYGHANWRSL PKLAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TREEEDAIIT LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLPQNY  120
RQSHDQKRSK KQAKLDGDAS KTNYQDAKLE QQDEPVNNMH SHASTKEDNG TEDMPLSPPQ  180
CSSDMSSLTT SDNNSSINNN TNNCDMSLHV NDIDTPENNL ALDEDFWSEV LSSDDNSGET  240
SGFPSIDYGR FEPMSSKEGV LIDGSSSSMC DGMDFWCNVY ARAEEFNQLL EL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162544.10.0hypothetical protein PHAVU_001G161000g
SwissprotQ7XBH43e-74MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLV7CYR80.0V7CYR8_PHAVU; Uncharacterized protein
STRINGGLYMA03G31980.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.13e-77myb domain protein 15